PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR12G03440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 184aa    MW: 20760.4 Da    PI: 7.344
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR12G03440.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.42.5e-113880145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     r+ W+  E  ++v+av+ +G++ ++ I+r++g +++ ++ck ++ 
  LPERR12G03440.1 38 RNDWSDNEKSKFVRAVRIHGKN-FTMISRYLG-TKSIEECKIYFS 80
                     789*****************99.*********.********8875 PP

2Myb_DNA-binding27.76.2e-09101143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       W+  +  ++v+a   +G++ ++ I+r++g +R+ ++c+ ++ k 
  LPERR12G03440.1 101 DWSDRDKSKFVQALSIYGKN-FTMISRYIG-TRSIEECITFFAKT 143
                      6*****************99.*********.*******9998775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-63582IPR009057Homeodomain-like
SuperFamilySSF466893.52E-123688IPR009057Homeodomain-like
PROSITE profilePS5129314.2623687IPR017884SANT domain
SMARTSM007172.4E-73785IPR001005SANT/Myb domain
PfamPF002491.3E-83880IPR001005SANT/Myb domain
CDDcd001671.18E-74179No hitNo description
PROSITE profilePS5129314.52997148IPR017884SANT domain
SuperFamilySSF466892.54E-1098143IPR009057Homeodomain-like
SMARTSM007173.3E-698146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.4E-4101138IPR009057Homeodomain-like
PfamPF002493.2E-6101142IPR001005SANT/Myb domain
CDDcd001675.47E-7102140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAIGESSSAR EAFRGPKSRA PCPYNSGDSK FDHSELDRND WSDNEKSKFV RAVRIHGKNF  60
TMISRYLGTK SIEECKIYFS KAQRVLNLDM IAVESELEGD DWSDRDKSKF VQALSIYGKN  120
FTMISRYIGT RSIEECITFF AKTRGAGVAG RINMATMEAT MAINEDYFDA DIDSTFAAIR  180
PGLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9XX401e-135A0A0D9XX40_9ORYZ; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-12MYB family protein